Protein FASTA: Ambiguity Codes X, B and Z (.fasta)
Three synthetic protein sequences that begin with methionine and include the X, B and Z ambiguity codes, which are legal IUPAC residues rather than errors. A validator restricted to the twenty standard amino acids rejects all three files.
>NXP001 synthetic protein, contains X B Z ambiguity codes
MFPHWMVITYAVNGYHVGKYQLGSGLGIIENMATCIQHRMPILWEVRSSEKSHYCIQNYD
XBZTIFDHMVKCNNKMLVNEGYTYVRDTKW
>NXP002 synthetic protein, contains X B Z ambiguity codes
MWYANKCSETRWGSQTIMCGVYCAGHIRADGKLVQVDWQWTYHCYLDELTTLNYRPLRCY
XBZAVPKADYADISKWTNVHQFFDRMDKNH
>NXP003 synthetic protein, contains X B Z ambiguity codes
MDEFFGMVNNFHMMQIGRTYSLGCIHAGDFHDRLDRARRRREQTMFMWQGTQGDWSLHFN
XBZHLSNSTQWSWKGSRQANRTHHQAHVKH
Specifications
- Records
- 3
- Sequence Length
- 90
- Alphabet
- 20 amino acids plus X, B, Z
- Ambiguity Codes
- X (any), B (Asp or Asn), Z (Glu or Gln)
- Starts With Methionine
- true
- Seed
- 20260850
Testing contract
Expected to pass- Scenario
- Parse the records and validate every residue against the full IUPAC amino-acid alphabet including ambiguity codes.
- Expected result
- Three sequences validate with X, B and Z accepted as legal residues at positions 61 to 63, and a strict twenty-letter validator rejects each record at position 61.
What is a .fasta file?
FASTA is the plain-text format for biological sequences. Each record begins with a `>` header line carrying an identifier and free-form description, followed by the sequence itself wrapped over as many lines as needed using IUPAC single-letter codes for nucleotides or amino acids. It records no quality or alignment information, which is what keeps it universal.
How to use this file
Use an example .fasta file to test sequence parsers and pipeline entry points, checking multi-record splitting, tolerance of varying line widths and blank lines, correct handling of ambiguity codes, and that description text after the first whitespace is kept separate from the identifier.
How to use this file for testing
“Protein FASTA: Ambiguity Codes X, B and Z (.fasta)” is a deterministic Testaroo fixture for Scientific data, Editor testing, Error handling. Citation catalogs (BibTeX, RIS), chemistry structures (MDL Molfile, PDB), and gridded binary data (NetCDF, FITS), for testing reference managers, molecule viewers, and scientific-data loaders.
Documented properties for this file: seed 20260850 · 3 records. Compare results against paired or grouped companions on this page when present (clean↔damaged, searchable↔scanned, or format twins) so scores stay reproducible across runs.
Download the file once, keep the path stable in CI or local scripts, and treat the spec table as the contract: dimensions, seeds, field lists, and roles are intentional. Corrupt or invalid samples are labelled as such, expect parsers to fail loudly rather than silently accept them.
Scientific fixtures are small, valid, and fully synthetic, no real organism, patient, sample, or observation. Point your parser or loader at the file and check it reads the documented records, variables, or headers; binary formats ship a readable twin or metadata listing for comparison.
Generated by generation/scientific.py. Free for any use, no attribution required, license.
Related files
- fastqIntentionally Corrupt FASTQ: Final Record Missing Its Quality Line (.fastq)An intentionally corrupt FASTQ whose first five records are complete and whose sixth ends after the plus line, leaving no quality string. A four-line-block reader must report an incomplete final record rather than pairing the sequence with an empty quality string.

- csvCensored Values and Detection Limits: Non-Numeric Results (.csv)Nine laboratory results where only four are plain numbers: two are below the detection limit, one is above range, two are missing in different spellings, and one is a legitimate small negative near the blank. Coercing the censored strings to numbers or to NaN both bias the summary, and the file distinguishes every case explicitly.

- cifCIF Parser Edge Cases: Quotes, Text Fields and Wrapped Loops (.cif)A CIF built entirely out of the constructs that break naive parsers: quoted values containing apostrophes and hashes, a semicolon-delimited multi-line text field, the distinct '?' and '.' markers, a standard uncertainty written as 1.2345(7), and a loop whose rows wrap across lines. Every one of them is legal CIF.

- jsonIEEE-754 float64 Boundary Values: JSON With No NaN Literal (.json)The same boundary values as strict RFC 8259 JSON, where non-finite numbers are null in the numeric field and text in the string field because the standard has no NaN or Infinity literal. It is the fixture for the encoder that emits bare NaN and produces JSON nothing else will parse.

- jsonIntegers Beyond 2^53 in JSON: Silent Identifier Corruption (.json)Six large integers written both as JSON numbers and as strings, including the 2^53 boundary where consecutive integers stop being distinguishable in a double. A parser backed by doubles turns 9007199254740993 into 9007199254740992 and reports no error at all.

- mtxIntentionally Corrupt Matrix Market: Declared Count Exceeds the Entries (.mtx)An intentionally corrupt Matrix Market file whose banner and size line are perfectly valid and whose entry block stops seven lines short of the declared count. A reader that preallocates from the declared count and never checks ends up with seven silent zeros.
